PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G13880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 312aa    MW: 34112 Da    PI: 5.4418
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G13880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.3e-11120178563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l++l+     l+se+
  LPERR04G13880.1 120 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSMLQRDTTGLTSEN 178
                      9************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-18116180IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139118181IPR004827Basic-leucine zipper domain
PfamPF001701.2E-9120178IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-11120175No hitNo description
SuperFamilySSF579592.18E-11120175No hitNo description
CDDcd147033.24E-22121170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDPAASTSAA ESSRDVVAAM PDSPPRRAAR HRRAQSEILL GAALPDDIGF DADLGVVGEV  60
GGGGDDYEEE EDEDYDEEGA GGSRMFEMFL EAGGKLEMGA DAKKAISDAK LAELALVDPK  120
RAKRILANRQ SAARSKERKM RYIAELERKV QTLQTEATTL SAQLSMLQRD TTGLTSENSD  180
LKIRVQTMEQ QVRLQDALND RLRDEIQKLK IATGQVNANC SKVGNFGLSS YGGANPQGYQ  240
RNHVQSLLAA QQLQQLQIHS QHQQQQMHLQ QQHLSTVQQQ LLQEDLKMKG IVAASHAQNA  300
GASESHALRS EP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0644291e-106AK064429.1 Oryza sativa Japonica Group cDNA clone:002-110-C11, full insert sequence.
GenBankAL6066271e-106AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAP0149601e-106AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-106CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8551961e-106CR855196.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0159F11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633411.11e-135PREDICTED: transcription factor RF2a-like
SwissprotQ040883e-75POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D9W6N70.0A0A0D9W6N7_9ORYZ; Uncharacterized protein
STRINGLOC_Os04g41820.11e-134(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.15e-62bZIP family protein